SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269836594|ref|YP_003318822.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269836594|ref|YP_003318822.1|
Domain Number 1 Region: 155-464
Classification Level Classification E-value
Superfamily Phase 1 flagellin 6.28e-24
Family Phase 1 flagellin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269836594|ref|YP_003318822.1|
Sequence length 471
Comment flagellar hook-associated protein FlgK [Sphaerobacter thermophilus DSM 20745]
Sequence
MFPTFGRLETLLRALQTQQRAVDVTNHNIANANTPGFSRQVAALGTTPPYTIPTLSAPRV
GQIGTGVTVLSVQRIREGFLDVQYRTQAEQLGMSEAKTAIYRTLDTLLNEPSETGLGAAL
DKFWAGWEEVANRPEHVPTRQALIEVAQTLAHRFNAMRNQVLQQREEAAHRLALEADRIN
QIAQQIASLNAQIRGVLAMGQQPNDLMDTRDQLLDQLARSIGTTTTVTPDGAINVYIAGH
ALVDRDQTDALRVTFDPVTGNAELTWVSDGRSVDVTLGAAAGLIEMHNVALPGILGDLEA
LRDTLVAEVNARHQAGFGLTDTGPTPPGRDFFEILPNGDLRVLPALTADPSLLAVASAPG
VPGNADIALAIAGLAEELTMGSGTATINTFYETFIARVGREAERAEADRVNQESLTRAID
RRRQEVAGVSLDEEAVNLIKYQHAYQAAARAMTVVDEMLDKLINGTGLVGR
Download sequence
Identical sequences D1C183
479434.Sthe_0562 gi|269836594|ref|YP_003318822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]