SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269836779|ref|YP_003319007.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269836779|ref|YP_003319007.1|
Domain Number 1 Region: 85-219
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.94e-50
Family Molybdopterin synthase subunit MoaE 0.0001
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily MoaD/ThiS 1.51e-20
Family MoaD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269836779|ref|YP_003319007.1|
Sequence length 232
Comment MoaD family protein [Sphaerobacter thermophilus DSM 20745]
Sequence
MRVTIRYFAVLREAAGRSAEERVLSPGTSVGDLLDRLAEDYPIVDRLRAYSRVMVNQEYV
PLDHPLSDGDEFVIIPPVSGGAGPFRVVQEPIDPDEVTAAVAAPDAGAIVTFQGTVRDNA
RGRRVLYLEYDAYPAAAEKTLAQIGDEIRERWGIDRVAITHRIGRVEIGEPSVVIAVASP
HRAEAFDACRYAIDRIKEIVPIWKKEAYEGGETWIGSEAAYQEKFGHSTSRK
Download sequence
Identical sequences D1C1R8
gi|269836779|ref|YP_003319007.1| 479434.Sthe_0748 WP_012871232.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]