SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269836886|ref|YP_003319114.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269836886|ref|YP_003319114.1|
Domain Number 1 Region: 7-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000000288
Family DNA polymerase beta, N-terminal domain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 76-151
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000000994
Family Achaeal helicase C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269836886|ref|YP_003319114.1|
Sequence length 169
Comment PHP domain-containing protein [Sphaerobacter thermophilus DSM 20745]
Sequence
MNRSTVTNHEAALILLNIATILEMTAGNPYRVRAYRRAARRLLALREPATEYLTPSGELA
LPGLGTRLRRKLGELFTEGEMRFYRDLYHSLPEELLRLMEVEGIGPRRALRLHVELGLGS
PEDVVQAAEAGRIRKLYRFGEKLEANLAEAARAAIAARRTEPVALPQAA
Download sequence
Identical sequences D1C225
479434.Sthe_0855 WP_012871339.1.32378 gi|269836886|ref|YP_003319114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]