SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269836915|ref|YP_003319143.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269836915|ref|YP_003319143.1|
Domain Number 1 Region: 232-316
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000123
Family Apolipoprotein 0.017
Further Details:      
 
Weak hits

Sequence:  gi|269836915|ref|YP_003319143.1|
Domain Number - Region: 43-314
Classification Level Classification E-value
Superfamily ARM repeat 0.00173
Family MIF4G domain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269836915|ref|YP_003319143.1|
Sequence length 366
Comment hypothetical protein Sthe_0884 [Sphaerobacter thermophilus DSM 20745]
Sequence
MIGGLDKQSQEPRRRHVQAPGTNPGDQSEGAPASDKRLEQRIAEAIQPVLPRVQEQAVQA
LHAQLQESFQPGTTPSEQKPADNGNGTGTVGTIVRPLVSTIPEVLREQGEQPLRSLVLDA
LDTIFSDSVRARFQHDAESTLRELVDITLEVIPDTESRDDLRMHLQRTLDELLQETLDQI
FSGPLRADIEGHAERAIDALVAGDSAEAVRQSKLVVLTLVHDFSAVLQEHWHQVLRLLLR
VVTAALQEVVTSAIKKGLESVVAEPAEELAEQADSVQDRLQEKGEELRDELKRAVEALRE
LIEEGTEELQERIQESVRSSVTGQGRPRGGFGHPPSGRPPSGRPPSGRPPSGRAPRGPRA
IAPPSR
Download sequence
Identical sequences D1C254
gi|269836915|ref|YP_003319143.1| 479434.Sthe_0884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]