SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269836925|ref|YP_003319153.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269836925|ref|YP_003319153.1|
Domain Number 1 Region: 590-738
Classification Level Classification E-value
Superfamily Lysozyme-like 8.59e-45
Family Bacterial muramidase, catalytic domain 0.0009
Further Details:      
 
Domain Number 2 Region: 286-451
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000269
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 3 Region: 127-167,199-331
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.00000000392
Family Protein prenylyltransferase 0.037
Further Details:      
 
Domain Number 4 Region: 48-177
Classification Level Classification E-value
Superfamily TPR-like 0.0000000196
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269836925|ref|YP_003319153.1|
Sequence length 746
Comment Lytic transglycosylase catalytic [Sphaerobacter thermophilus DSM 20745]
Sequence
MVRAPVKLVSVFVLLVALAVAATTALPERNGEPTPMVREGVQGWDPGPGAAELAPARRML
AEGDAEAAAASARQLVGDASPELDAAARLVLARSLLAVGEAGEALVVLTALRDGDRSPAI
AAAADLLLGRVHAAMGQTAEALAAYRRAAERDPSVEVYAALRRIEVLRDSGQLEAAQDAA
EAAAGLPAIRRTHVAVLEALREIQSELDDGNGYLATTHRLLDVATLPHYRAQLAFQAGQF
ELQIGQREAAIRDLQAAVSAAPDSAHAVAALDALIAQDAADAVEPYQRGLVLYHAGRDQD
AIVAFTAALENDPTNHEARYYRGLSRARAGNVPGGVEDLREVARTASDRELAGRALEQAA
RWLESAGDTAGARAVYQEVLARYGNTGAAASARFRLGFMSYLERDFGAALTIWADGGDAR
VHFWLGKAREIAGDDAGARAAWEEAARLEPDGYYGLRAADLLGGEPVPSTGQALVGAVIG
DAVWRELASWFPERGVDPNAAREALEAEPGLRRAMILLDAGMMQEAGWEIDALAEEHAGD
VERLVTLGGVLAERGETTAAAEAVAPLVNVEEGQERSLPPILERLSYPIPYLDLLSEAAE
RHGADPLLLAALVRQESGFNPQARSSAGALGLAQIMPETGREIARRLGWQDFNPRDLLRP
EVSLEFGARYLAERMERYNGYLFAALAAYNAGDSPVNEWLAAPGAEDPDVFAESIPYPET
YDYVRRVYVNYQHFLRVYAQPDAGER
Download sequence
Identical sequences D1C264
WP_012871378.1.32378 479434.Sthe_0894 gi|269836925|ref|YP_003319153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]