SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269837100|ref|YP_003319328.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269837100|ref|YP_003319328.1|
Domain Number 1 Region: 10-309
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.75e-45
Family DmpA-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269837100|ref|YP_003319328.1|
Sequence length 314
Comment peptidase S58 DmpA [Sphaerobacter thermophilus DSM 20745]
Sequence
MSDGEWEPFEIAGFRVGHWTHPTGATGCTVIVADAPALAVADVRGGAPGTREVALLEQGR
LVQRVDAVLLTGGSAFGLAAADGVVAWLREHGRGFPTSSIPVPIVAGAVIFDLDGPTPPL
PTADSGYEAAANAVPHGWISGRVGAGSGATAGKLAGRARATPTGIGSTYVQTELGALGAL
FVVNPYGDVVDPETGQILAGTRGDAPGTWADTERAILRGGSSDEDSAFNTVIGVVAIDGE
MDRDALVRVAVAAHDGIARAVRPAHTLFDGDVVFVLARREGSPPDNAVLTWCTAAQRAVA
EAIVRSVRRPEGQG
Download sequence
Identical sequences D1C2N9
479434.Sthe_1070 gi|269837100|ref|YP_003319328.1| WP_012871553.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]