SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269837137|ref|YP_003319365.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269837137|ref|YP_003319365.1|
Domain Number 1 Region: 6-550
Classification Level Classification E-value
Superfamily Urocanase 1.14e-258
Family Urocanase 0.000000000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269837137|ref|YP_003319365.1|
Sequence length 555
Comment urocanate hydratase [Sphaerobacter thermophilus DSM 20745]
Sequence
MIEGQPREVRAPRGTELSCRGWQQEAALRMLMNNLDPEVAEAPQELIVYGGTGKAARNWA
CFDAIVRELRQLGDDETLLVQSGKPVAVFRTHELAPRVLISNAMLVPQWATWDEFRRLEA
LGLTMYGQMTAGSWIYIGTQGILQGTYETFAEVARQHFDGSLSGRVVLTAGLGGMGGAQP
LAVTMNGGVALVVEVDPERIQRRVRIGYCDAWTADLDDALRQVEAARRERRPFSIALLGN
AAEVLPDLLKRGFMPDVVTDQTSAHDPVGGYVPAEISLEDALLLRQKSPEIYTDRAMRSM
AQHVQAMLEFQRRGAVVFDYGNNLRGQALVAGVEDAFAYPGFVPAYIRPLFCQGKGPFRW
VALSGDPEDIRKTDQAAIELFPENEALRRWLTMAEEKVPFQGLPARICWLGYGERARFGL
RLNEMVRTGELKAPIVIGRDHLDTGSVASPYRETEGMRDGSDAIADWPILNALLNTASGA
SWVSVHHGGGVGIGLSIHAGMVVVADGTPEAARRLERVLTNDPGIGVMRHVDAGYPEAIA
FAEENGLRAPIPPSQ
Download sequence
Identical sequences D1C2S6
gi|269837137|ref|YP_003319365.1| 479434.Sthe_1107 WP_012871590.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]