SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269837304|ref|YP_003319532.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269837304|ref|YP_003319532.1|
Domain Number 1 Region: 12-380
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.99e-108
Family DmpA-like 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269837304|ref|YP_003319532.1|
Sequence length 384
Comment peptidase S58 DmpA [Sphaerobacter thermophilus DSM 20745]
Sequence
MGDTIATNRGLRPRLRDLGIVIGTLPPGPLNAITDVPGVRVGHATVIHGDGPLRPGHGPA
RTGVTAVHPHEGSAFASMVPAAIAVLNGAGEITGRSQVDEYGLLETPILITNTHSVGVAH
RACVEWLGRRTPTIGREHFVIPVVAETFDGFLNDGAAQHVTEAHVFAALDSAAEGPVAEG
NVGGGTGMLLFGFKGGTGTASRVVEIDNHRFTVGVLVQGNFGAREDLLVDGVPVGLEITD
LLPTPGEIAAAPETDGSVIVVIATDAPLSDRQLGRLCRRGMLGLARVGATARNTSGDLLL
AFSNAPENRVERGDDRVILPSARLADTRMDILFQATIEATEEAVLNALVAAETMTGRNGN
TAYAIPHDRLQEVMARYGRLRSTR
Download sequence
Identical sequences D1C393
479434.Sthe_1275 WP_012871757.1.32378 gi|269837304|ref|YP_003319532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]