SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269928959|ref|YP_003321280.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269928959|ref|YP_003321280.1|
Domain Number - Region: 90-176
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0288
Family DmpA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269928959|ref|YP_003321280.1|
Sequence length 204
Comment RES domain-containing protein [Sphaerobacter thermophilus DSM 20745]
Sequence
MSRVPRKPAPGPHPLPPPDLPSRELPIVTATGPWFRLHRACRDPLHFGRSAVFRFDDPEG
NYGVLYVGEDPHCAFIETFGKGPNAAGVVTLAALAERELARVDASQPLRLVDLTGPGLAR
LGADGRLCSGDYVIAQVWARALWAHPSQPDGILYRSRHDPSRACAAIFDRAAPFLQATRL
PGLADPANRSLLAAILDAYGFGLI
Download sequence
Identical sequences D1C9G5
479434.Sthe_3057 gi|269928959|ref|YP_003321280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]