SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269837469|ref|YP_003319697.1| from Sphaerobacter thermophilus DSM 20745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269837469|ref|YP_003319697.1|
Domain Number 1 Region: 46-210
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.43e-21
Family Biotin dependent carboxylase carboxyltransferase domain 0.094
Further Details:      
 
Domain Number 2 Region: 393-455
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000183
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269837469|ref|YP_003319697.1|
Sequence length 474
Comment hypothetical protein Sthe_1440 [Sphaerobacter thermophilus DSM 20745]
Sequence
MRQQLRQQRRRVGNRPVQQLTLLGALLCFLVAALLASPAPARAAPNRVYGLTIDGVINQL
TADHVVRVLDEAEREHGAVLLVTIDSPGGVDSAIRRITQAFLAARIPVVVYVGPEPQAEA
LSGAMFITLAGHVAAMAPDAVIGAALPAGLAERASPEEREERMANALQVAATTAEARGRN
VQATVDAVRAEEILSADVAAADGIIDQVAPSVPLLLEQIDGLEVRTASGTVTLATREAPI
RWMTLTPRERVVQEITNPNVAYLLFSAGVLLLIVAVYASAHLLAGIPAIVALATAIIAFG
NLPTSWVGLGLLTAGALLFIVELYTPKVGLPGAAGVICYLIGSFTLYQPVRQESPFAPVV
RVNPWLAVGTVSFFVVALLLILRFLFRARRTALASTAAALIGRTGVVVRPLDPVGTVLVA
DQEWAATSPDAPLSEGSPVRVTGSEDGLLRVMPLPPDVAQSDSREGAHRGWRAP
Download sequence
Identical sequences D1C3Q8
479434.Sthe_1440 gi|269837469|ref|YP_003319697.1| WP_012871922.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]