SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162148557|ref|YP_001603018.1| from Gluconacetobacter diazotrophicus PAl 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162148557|ref|YP_001603018.1|
Domain Number 1 Region: 497-518,556-806
Classification Level Classification E-value
Superfamily HAD-like 8.93e-51
Family Meta-cation ATPase, catalytic domain P 0.00056
Further Details:      
 
Domain Number 2 Region: 304-397
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.96e-26
Family Calcium ATPase, transduction domain A 0.0037
Further Details:      
 
Domain Number 3 Region: 254-300,398-490
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000000458
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162148557|ref|YP_001603018.1|
Sequence length 812
Comment copper-transporting P-type ATPase [Gluconacetobacter diazotrophicus PAl 5]
Sequence
MLLDNCRPITVVRPPAAPIEGHGMSQTHQPGDQRPSSPGTVWTCPMHPEVRETQPGKCPK
CGMTLQQADETGAMPSMPGMNNHQMRHAMTRHDPEHASPTSMKAALPSAGSHTIWTCPMH
PQIRRDDPGNCPLCGMALEPEEPAGQSEESPELKDFTRRLIVAAALAVPLLIVSMGGDVG
LRLLPPVLSPWVQLALTLPIVCWAGLPFFQRGLASLPTLHFNMFTLIMFGVGAAFGYSLA
ATFAPNVFPATFRTPDGTLPVYYEAAGVVVALVLLGQVLELRARAATGNAIRALLDLTPK
QAHRIGADDREQDVPVEDVMKGDRLRVRPGESVPVDGTVLDGASSVDESMITGEPAPVEK
KAGDPVTGGTINGTGSLEIEAQAVGSDTMLARIVKMVASAQRSRAPIQTVADRVSGWFVP
LVLAVSIVTFIVWYAVGPAPRFGHALLNAISVLIIACPCALGLATPMSVMVGTGRGAREG
VLVRDAGALQAVDKVDTLVVDKTGTLTEGHPKLIALDVAEGWREDEVLRPAASVEAESQH
PLAQAVVRALKERHGEPAPVGDFASQPGLGVSGTVNGHQVVIGNAERLKQAGVDTAPLEA
TAGARRQDGAGVMFVAIDGRLAGLIAVADPLRADTKAALAALHADGLRIVMLTGDNEATA
AAVAKAAGNIAEIHAGLKPQDKADIIRRLEAAGAHVAMTGDGVNDAPALAAASVGIAMGT
GTDVAIESAGITLAHGSLGALVRARTLAHDTMHNIRQNLAFSFLFNGIGIPVAAGVLYPV
FGLLLSPMIGGAAMALSSVTVITNALRLGKTP
Download sequence
Identical sequences A9HQE3
WP_012226943.1.42434 gi|162148557|ref|YP_001603018.1| 272568.GDI_2781 gi|162148557|ref|YP_001603018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]