SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529223946|ref|YP_008384767.1| from Streptomyces collinus Tu 365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529223946|ref|YP_008384767.1|
Domain Number 1 Region: 104-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.6e-48
Family C-terminal domain of adrenodoxin reductase-like 0.0000132
Further Details:      
 
Domain Number 2 Region: 3-165
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.18e-16
Family N-terminal domain of adrenodoxin reductase-like 0.00056
Further Details:      
 
Weak hits

Sequence:  gi|529223946|ref|YP_008384767.1|
Domain Number - Region: 321-439
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00347
Family N-terminal domain of adrenodoxin reductase-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529223946|ref|YP_008384767.1|
Sequence length 446
Comment NADPH-ferredoxin reductase [Streptomyces collinus Tu 365]
Sequence
MLRVAVVGSGPSGCYIAQTLVQLDPEVRVDVLDRLPCPYGLVRYGVAPDHEKIKSLQGSL
RTVLEHERVRFLGGVRVAGPGGLSVARLRSLYHAVVYCVGAAADRRLGIPGEELPGSWSA
TEFVSWYSAHPDAADAGFVRGVRSAVVIGVGNVAVDVTRMLVRGAGELRPTDMPQAALDA
LAASGVAEVHMVGRRGPSQARFTTKELRELGGLPGTEVVVEPAELALDPACADAAALPAV
QRRNVEAMRGWAAAGPASPGRRIRLRFFLRPVEVLADGGRVGGVRFERTAPDGHGGVTGT
GRYEDVPAQLVLRSVGYRGVPLEGLPFDPVNGTVPHREGRVLRDGVTSPGEYVAGWIKRG
PTGVIGTNRPCAKETATSLLADAPALARTEVPGDALPALRAAGLEPVPWAGWQAIERAEA
ELGARLGRVVVKLADWDALMGAARTA
Download sequence
Identical sequences S5UQ62
WP_020938440.1.98377 gi|529223946|ref|YP_008384767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]