SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529239205|ref|YP_008400063.1| from Streptomyces collinus Tu 365

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|529239205|ref|YP_008400063.1|
Domain Number - Region: 277-359
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0017
Family Apolipoprotein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529239205|ref|YP_008400063.1|
Sequence length 756
Comment large alanine-rich protein [Streptomyces collinus Tu 365]
Sequence
MSSRRQPARKAPAKKTTTRVKTTTAIRTTATVGLSEGPGTTVATEPAPAPGSGPGPDWEA
LARLLDARDRAADIIDTAREQALVLQTQAEEQAARTVADTHEQATALLADARTRAEVVTL
GAQEEASAQRAAVTTEAETVREEAQKLRGEADQLLAEARTRADQLLAQARSQVAELTELA
AADHQATASAIAELRRLAEADLTEIGALVEGRRAEAGQILARAREEADNLLAAVQKEVEQ
ARARHAQLAKAAAEQYDARRIEAETLYADAVEAAAERRREADAHVAAAHTEAEEARAELR
AELRQLGEKFDTEAAAKRQALTEELAGLKTACDRQREKLRTEATSVTQELREAAQKQAAR
ITAEAERKAKGITDRAQADEARARRLLNEAREAKKSAAKWRRRRQNLGGKLWKAAPWVAL
AAGVGLAASGEYELARMVGINDYVAPLLPVSIDVYCVTAFRTKKDIVPALLLMASANVVF
HLSDQAKLVPEGGSAPWQLTTFVVLIFVAVIWRVHTLMYTDGTDGHGGTDTPSGTATATP
LRAGTDGNGTLARTGTHRRTDGTDSTTSGRTNDLYAANSGGRADGTGPGRDGTDPVSALT
HSPHHDGGEGALTREYSDRTYDVHTTPDGAARTGTAARGRTGTAHAAVQGRGSTVSVRTQ
PGREGVQGGRTGTATVSSRATGTSGTGRTGGTDRPGTPARTDEELLPLVQALPRDEDGYV
TLYRVRTDLSVNQPRAVRLLKEAGLLRPEDADKYLT
Download sequence
Identical sequences S5V2S1
gi|529239205|ref|YP_008400063.1| gi|529239205|ref|YP_008400063.1|NC_022001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]