SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529223443|ref|YP_008384264.1| from Streptomyces collinus Tu 365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529223443|ref|YP_008384264.1|
Domain Number 1 Region: 18-329
Classification Level Classification E-value
Superfamily SIS domain 9.33e-49
Family double-SIS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529223443|ref|YP_008384264.1|
Sequence length 333
Comment sugar isomerase domain-containing protein [Streptomyces collinus Tu 365]
Sequence
MLKFNEAEFVAQTESLVALRPRIEEVVDRLHGEGYDNVLLVGAGGTYAQMWPYEHLARRA
STLPVRAAVAAELVVSGDARLGERTVAVFTSVSGTTEDSLRAIEYCKGRGAHTIGFTGYP
DSPVARSVDTALVSEPKAWPFDVQMLLFTLRLLCLRGEFEGYERLADELAALPRILVDVA
RRAEPVASDFAEAHKETDYHFLIGGGNLWGFTYLYSMCILEEMQWLRTTRVHSAEFFHGS
LELLEEDTSVLLFQGEDETRALTDRAEAFARRVSKDVTVFDTRDYPLDGISPEFRGLLSP
LVMDTVMDRVSKHLERVRDHSLDLRRYYRVMDY
Download sequence
Identical sequences S5UKR1
WP_020937937.1.98377 gi|529223443|ref|YP_008384264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]