SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529225951|ref|YP_008386772.1| from Streptomyces collinus Tu 365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529225951|ref|YP_008386772.1|
Domain Number 1 Region: 98-374
Classification Level Classification E-value
Superfamily SIS domain 4.77e-45
Family double-SIS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529225951|ref|YP_008386772.1|
Sequence length 375
Comment hypothetical protein B446_15715 [Streptomyces collinus Tu 365]
Sequence
MLDESLLDSPEGLGEADRRGLLRGAAEAGARVRTAARHAAEAGVRELKPDGRPRAVLIAG
PGAAATHTADLLGSLAGPGSPVIRLAPTGVAPAAGALRWELPGWAGSVDLLLLATPDGTE
PSLSLLAEQAYRRGCSVVAVAPAGTPLAEAVSGAHGLLVPMATAPYDQEEPLAASSSGVF
WALLTPLLALLDRIGLLTAAPDDLEKVADRLDHIAERCGPAIATYSNPAKTLAAELADSL
PVVWTEGTSAGPAGRRFAAALAELAGRPAVVAELPEALAAHSALLAGPLAASADPDDFFR
DRVEEPPALHARVVLLRDRPIGGLTAAPGARDLALSHDTPISELEPEEGGDLETLAELIA
VTDFAAVYLALASGA
Download sequence
Identical sequences S5UVX0
WP_020940430.1.98377 gi|529225951|ref|YP_008386772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]