SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529226293|ref|YP_008387114.1| from Streptomyces collinus Tu 365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529226293|ref|YP_008387114.1|
Domain Number 1 Region: 13-254
Classification Level Classification E-value
Superfamily SIS domain 4.04e-65
Family mono-SIS domain 0.000000439
Further Details:      
 
Weak hits

Sequence:  gi|529226293|ref|YP_008387114.1|
Domain Number - Region: 251-284
Classification Level Classification E-value
Superfamily UBA-like 0.0222
Family TS-N domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529226293|ref|YP_008387114.1|
Sequence length 307
Comment N-acetylmuramic acid-6-phosphate etherase [Streptomyces collinus Tu 365]
Sequence
MTSHDLRSELESLTTEAFRPDLAEIDRLSTLDIARLMNGEDAGVPAAVAARLPQIAAAID
AVAARMSRGGRLVYAGAGTAGRLGVLDASECPPTFNTDPAQVVGLIAGGPQAMVTSVEGA
EDSRELARRDLAALGLGPDDTVVGISASGRTPYAIGAVEHARALGALTVGLACNEHSALA
AAAEHGIEVVVGPELITGSTRLKAGTAQKLVLNMLSTITMVRLGKTYGNLMVDVRASNDK
LRARSRRIVALATGAPEEEIEKALTESGGEVKNAILALLTGVDGPTAARLLEDSGGHLRA
ALAAAAT
Download sequence
Identical sequences S5UT31
WP_020940771.1.98377 gi|529226293|ref|YP_008387114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]