SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160895628|ref|YP_001561210.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160895628|ref|YP_001561210.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.09e-78
Family Acetamidase/Formamidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160895628|ref|YP_001561210.1|
Sequence length 410
Comment formamidase [Delftia acidovorans SPH-1]
Sequence
MTDTLIKVDLNRPPTDNERVHNRWHPDIPMACWVQPGDDFILETYDWTGGFIKNNDSADD
VRDIDLTTVHYLSGPVGVKGAQPGDLLVVDLLDIGAKPDSLWGFNGFFSKNNGGGFLTDH
FPSAQKSIWDFKGMFTSSRHIPGVNFPGLIHPGLIGCLPDRPMLEMWNERERALIATDPD
RVPGLANPPSAGTAHMGQMRGEARDKAAAEGARTVPPREHGGNCDIKDLSRGAKVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKGGMAKYGIKNPIFKPSPITP
RYDDYLIFEGISVDESGRQHYLDVNVAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQG
HISGVVDVPNSCATLWLPTGIFDFDINPNAAGPVVQFDGSIDMPLSPDLR
Download sequence
Identical sequences A0A286J8X6 A9BPF8
WP_012202118.1.82428 398578.Daci_0179 gi|160895628|ref|YP_001561210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]