SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160895674|ref|YP_001561256.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160895674|ref|YP_001561256.1|
Domain Number 1 Region: 19-167,210-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.2e-157
Family SCOPe 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160895674|ref|YP_001561256.1|
Sequence length 409
Comment formamidase [Delftia acidovorans SPH-1]
Sequence
MAETLIKVDLNQSPYDNPQVHNRWHPDIPMAVWVEPGAEFKLETYDWTGGAIKNDDSAED
VRDVDLSTVHFLSGPVGVKGAEPGDLLVVDLLDIGARDDSLWGFNGFFSKQNGGGFLDEH
FPLAQKSIWDFHGMFTKSRHIPGVNFAGLIHPGLIGCLPDPKMLASWNERETGLIATDPD
RIPGLANPPNATTAHMGQMQGEARDKAAAEGARTVPPREHGGNCDIKDLSRGSRVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKGGMAKYGIKNPIFKPSPMTP
NYKDYLIFEGISVDEKGKQHYLDVTVAYRQACLNAIEYLKKFGYSGAQAYSLLGTAPVQG
HISGVVDVPNACATLWLPTEIFDFDINPTAEGPQKIITGGVDLPIAQDK
Download sequence
Identical sequences A0A080NT24 A0A1H3IF09 A0A1I1B6B3 A0A210VU29 A9BPK4 S2WYF6
gi|160895674|ref|YP_001561256.1| 2wkn_A 2wkn_B 2wkn_C 2wkn_D 2wkn_E 2wkn_F 2wkn_G 2wkn_H 398578.Daci_0225 WP_012202164.1.14625 WP_012202164.1.21606 WP_012202164.1.21876 WP_012202164.1.33911 WP_012202164.1.66548 WP_012202164.1.76905 WP_012202164.1.82428 WP_012202164.1.93318 WP_012202164.1.99347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]