SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160896257|ref|YP_001561839.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160896257|ref|YP_001561839.1|
Domain Number 1 Region: 75-546
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-57
Family ALDH-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160896257|ref|YP_001561839.1|
Sequence length 552
Comment phenylacetic acid degradation protein paaN [Delftia acidovorans SPH-1]
Sequence
MPAHALYERHRPLLDDALQALSRRGHWSPFPEAPSPKVYGETAQAQGHAAVQALFGKDYP
LRQPGERARVATEQSPYGVALDIRYPECDAQALVDAAQAAEPAWQALGPQGRTGVLVEAL
TRIHQRSFEIAHAVMLTTGQGAMMAFQAGGPHAQDRALEAIAVAWKAMADVPAEAVWEKP
QGKHAPAVLHKRFEIVGRGVALVIGCATFPTWNTYPGLFAALATGNPVIVKPHPNAVLPA
ALTVSVLRDVLTEQGLDPNLVTLAVSDKPELTQALATHAAVASIDFTGGNAFGQWLQSNA
PQARLYAEMAGVNLVVIESTDAYAGMLRNLALSLSLYSGQMCTTTQNLLIPAGGIETDQG
HKSFEQVGADLAAAIDQLLADPKVAFTVLGAIGSAQTVERVEQAATVGRAVRASQKLTHP
EYPQAEVRTPALRALDVADAAIYERECFGPVSYLVAVPSAQAARELAERSVRAHGAMTLG
LYSTDAAFVDAVAASALRSRVALSINLTQGVMVNQSAGFSDFHATGGNPAANASYTTLAF
VADRFVVVQRRW
Download sequence
Identical sequences A9BS44
398578.Daci_0808 WP_012202740.1.82428 gi|160896257|ref|YP_001561839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]