SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160896409|ref|YP_001561991.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160896409|ref|YP_001561991.1|
Domain Number 1 Region: 6-484
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-159
Family ALDH-like 0.0000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160896409|ref|YP_001561991.1|
Sequence length 491
Comment aldehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MSNLELLPINIAGEWRLGGGGESTTLYPATGEVVGRLRAPSLEDVEEAIQKADHAFRTSG
WAQKKPHERAAVLHRVAQLIRERAEPLAQLQRLDNGKPIKETRMLVASAAATFQFFAAAC
ETMEETITPSRGDFMTMSVYEPMGVVAAITPWNSPIASEAQKLAPALAAGNAVVVKPAEA
TPLLALELARICEEAGVPKGLVSVLPGRGSVIGDAITKHPLVKRVSFTGGTSTGKHIAHI
AADKMMPVSLELGGKSATMVLADADIDHAVNGVLYGIFSSSGESCIAGSRLFVARSLHAE
FMQRLTAKAAALQVGDPADERTQMGPLITAKHRESIESYVALGLSEGGRLLTGGQRPEGA
QFERGYYYRPTIIDGVKNDWQICQQEIFGPVLVAMPFDNEDDLLAQANDSVYALAAGIWT
RDYKSAWRIGRAVQAGTVWINTYKQFSISTPFGGWRDSGLGREKGRLGIQQYMEQKSMYW
GLNDQPLAWAN
Download sequence
Identical sequences A0A286J718 A0A2G7T1L8 A9BRN9 F6B2K1
gi|333917156|ref|YP_004490888.1| WP_012202892.1.37708 WP_012202892.1.82428 gi|160896409|ref|YP_001561991.1| 398578.Daci_0960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]