SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160898540|ref|YP_001564122.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160898540|ref|YP_001564122.1|
Domain Number 1 Region: 171-324
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.92e-39
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0016
Further Details:      
 
Domain Number 2 Region: 16-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000215
Family AraC type transcriptional activator 0.0059
Further Details:      
 
Domain Number 3 Region: 68-119
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000672
Family AraC type transcriptional activator 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160898540|ref|YP_001564122.1|
Sequence length 326
Comment AraC family transcriptional regulator [Delftia acidovorans SPH-1]
Sequence
MTNKPSEQASRAEYARRINRVLNYIDAHLDQPLDGAHLADIANFSRFHFHRIFAAWMGET
LGSYAQRRRLEKAAFRLSCGSKETVLETALATGFQSGEAFARAFKLKFGCTPSAWRSTTL
ERMKTQAAAIGQPPGSQQSNPDQVFGNLHQEDLRAFGEPQGSCHLKEEIAMDVRIIDLPK
AHVAYQRLIGPYGPAIGQFWRGTIAPWMHSNGLSDQTCYGIGYDDPSLTPASKCRYDACV
EVPAHFVASGQVDTQTLPGGRYAVARFKGKPEGLANAWMWLTREWMPSSGMQCDDRPCFE
MFSAATAMDADTGEFCCDICIPVRAL
Download sequence
Identical sequences A9BU22
WP_012204938.1.82428 gi|160898540|ref|YP_001564122.1| 398578.Daci_3099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]