SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160898791|ref|YP_001564373.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160898791|ref|YP_001564373.1|
Domain Number 1 Region: 22-501
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-177
Family ALDH-like 0.00000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160898791|ref|YP_001564373.1|
Sequence length 502
Comment aldehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MNLSDIQHQITERASAFLNRGTHDLFIDGQWVAARTGQRLSTVNPATEAVIAEVASAGPA
DVDLAVRAAHRALHLGPWGRMRPVERERLMLRLADLMETHAQALAEVESLDNGKSAAIAR
AVDIAMAIDSIRYMAGWATKIEGMTHEHSVPFAPEAQMFTYTRREPVGVVAAVVPWNFPL
LMATWKLAPALAAGCTLVLKPAEQTPLTALMLAELIQEAGFPPGVFNVVTGDGPGTGAPL
VSHPLVNKVSFTGSTEVGKLIGHACMDNMTRITLELGGKSPVIVLDDCDPATAAAGAANA
IFFNHGQVCCAGSRLYVHKSMFDRVVADVADQAARLTLGHGLDPSAQMGPLVSQEQMERV
CSYIDIGRSQGAEVVTGGARAGQRGYFVQPTVMTGVQHDHRVAREEIFGPVLVAMPYDDL
DEVAAWANDTPYGLGASIWSNNLSKVHRLIPKIQSGTVWVNCHSTLDPGMPFGGYKQSGM
GRDMGRTALDAYLETKSVFINL
Download sequence
Identical sequences A9BZT0
WP_012205188.1.82428 398578.Daci_3350 gi|160898791|ref|YP_001564373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]