SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160900395|ref|YP_001565977.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160900395|ref|YP_001565977.1|
Domain Number 1 Region: 392-433,473-533,582-798
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 7.19e-80
Family Acetamidase/Formamidase-like 0.00038
Further Details:      
 
Domain Number 2 Region: 266-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000116
Family AraC type transcriptional activator 0.021
Further Details:      
 
Weak hits

Sequence:  gi|160900395|ref|YP_001565977.1|
Domain Number - Region: 215-255
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0836
Family AraC type transcriptional activator 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160900395|ref|YP_001565977.1|
Sequence length 810
Comment AraC family transcriptional regulator [Delftia acidovorans SPH-1]
Sequence
MHDDPRRFSTHAFPDALRQAALNEALSRADIHGEAPTPPATHLALRSSPLGSVFITLATS
PLTLRAVAKRLRGPGLLLCALLQGSANAVIEDAAFPLKAGSALLLESDRDWQLQLPGDGR
LLLARLESSSFLLRLLRSCPPEARHIGGTGGVGAMCMAMAASLAEQIDTLAQDDLLSVEA
TLTDMLVTCLTPRAGNPDQEQAEATEPPSAVQLGHLRRICRAIETRLGDAELSIDAIADA
EGLSTRYLQKLFKGAATSFSTYLRERRLERCRMDLSNRSLQHFSIAELCFRWGFGDAANF
SRAFTARYGLSPKAYRASPARVQDAPPGQRGRPSPAESAAQGAEPAAARLAHSPFQALLR
DHARYAQALALVPKRSAHADNGGASPQHYYLPVSDKTVHWGYLSRSLKPVLSVRSGDVVT
METLTQHASDDWERMIEGDPGAESVFHWTAAQKAVDRRGAGPMDASIYGRGAGEGFGVHI
CTGPVYVHEAEPGDLLEIRILDVQPRPSCSPAHHGRVFGSNAAAWWGFHYRDQITEPRQR
EVVTIYEIDHALPEEPTARAVYNYRWTPQTDPFGVVHPTIDYPGVPVDPATITRRFGVLD
KARVPLRPHFGMLAVAPREAGLIDSIPPSYFGGNLDNWRAGKGATLFLPVSVPGALFSVG
DPHASQGDSELCGTAIECSLTGSFELRVHKRAALDNRFLAELDHPFLETGSEWVIQGFSF
TDHLAELGSQAQSQVYRKSSLEGAMRDAFHKARRYLMLAHGLDEDEAVSLISVAVDFAVT
QVVDGNWGVHAVIKKALFPPELSASAQAGP
Download sequence
Identical sequences A9BMP7
398578.Daci_4963 WP_012206762.1.82428 gi|160900395|ref|YP_001565977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]