SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160900526|ref|YP_001566108.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160900526|ref|YP_001566108.1|
Domain Number 1 Region: 3-479
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-150
Family ALDH-like 0.000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160900526|ref|YP_001566108.1|
Sequence length 483
Comment aldehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MIEQTMLIAGQAAQAGNGATFERRNPLDGSVATRAPAATPEDAVRAVEAAQKAFPAWAAL
GPTERRQMLMKASQALEAKTEAFAAAMAAETGASGIWAGFNVHLAASMFLEAASLTTQIN
GQIIPSDVPGSLAMAVRQPAGVVLGIAPWNAPVILAVRAIATPLACGNTVVLKGSELCPA
THGLIIEALQEGGLPPGVVNFVTNAPEDAGAVVEAMVAHPAVRRVNFTGSTRVGRILGQT
CAKYLKPAILELGGKAPFVVLDDADIDAAVAGCTFGAFANSGQICMSTERIIVDESVAGD
FLDKLVARASSLPLGDPRKGPVVLGSVVDMATVERANRLIDDALAKGARLLCGGKATNTL
MAATLIDGVTPEMDIFREETFAPVKAIVRVRGEEQAIAMANDNEFGLSSSVYTRDTARGW
RVAARIEAGICHVNGPTVHDEAQMPFGGVKNSGYGHFGGQAGIDAFTETRWITMQTTPRH
YPF
Download sequence
Identical sequences A9BN28
gi|160900526|ref|YP_001566108.1| WP_012206893.1.82428 398578.Daci_5094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]