SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160900637|ref|YP_001566219.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160900637|ref|YP_001566219.1|
Domain Number 1 Region: 18-492
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-108
Family ALDH-like 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160900637|ref|YP_001566219.1|
Sequence length 498
Comment aldehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MCRDASLECGACKCLLTIEPMTQLDLHRVFDLQYQASRAQVDVPLLVRRERLLRMQKLLD
EHGPVLAAAVQADFGMRSPRLTEMVELFVLRNLLKHTLRHLARWSGRQRVRTPLMLMPGR
GWIERQPLGVVGVISPWNYPVQLALGPAITALAAGNRVMLKPSELTPHTSAQLAALVGQF
FAPEEFAVIEGDVSIATQFSGLHFDHLLFTGSTAVGRRVAQAAAAHLTPTTLELGGKSPC
IISTDCDLKEAALKIAHGKLVNAGQTCIAPDYVLLPRGQEAEFAEAFRTAARRLFPRFAG
NPDYAAILTKRHLARLRQMLRQAQGMGAHVEWMEDGGAGQESADTAWGDAVERQMAPALV
FNATSQMQLMQEEIFGPILPVISYDRLDDVVSAINAGPRPLALYWFGRDEKVRDAVLSRT
ISGGVTVNDTLLHFAHENLPFGGVGDSGWGAYHSEQGFARLSHQKAVFVQSRWSGASMLY
PPYGARFDRIMELMRRWL
Download sequence
Identical sequences A9BND9
WP_012207004.1.82428 gi|160900637|ref|YP_001566219.1| 398578.Daci_5205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]