SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160901081|ref|YP_001566663.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160901081|ref|YP_001566663.1|
Domain Number 1 Region: 16-499
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-159
Family ALDH-like 0.0000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160901081|ref|YP_001566663.1|
Sequence length 507
Comment aldehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MTVYAAPGAAGAKIAYKARYDNFIGGRFVPPVKEQYFDVVTPISGKVYTRAARSTAEDIE
LALDAAHAASDAWGRTSAAERANVLLKIADRIEANLELLAYAETVDNGKAIRETLNADIP
LTVDHFRYFAGCVRAQEGALSHIDETTVAYHIQEPLGVVGQIIPWNFPILMAAWKLAPAL
GAGNCVVLKPAESTPISILILAELIADLLPPGVLNIVNGFGREAGMPLATSKRIAKIAFT
GSTSTGRVIAQAAANNLIPATLELGGKSPNIFFADVMDKDDAFLDKAVEGLVLFAFNQGE
VCTCPSRALIHESIYDRFMERVLQRVAAIRHANPLDTDSMMGAQASKEQLTKILSYLDLG
KQEGAEVLAGGGQAHLGGDLEGGYYVQPTLFKGHNKMRIFQEEIFGPVLAVTTFKDEAEA
LAIANDTLYGLGAGVWSRNGNVAYRMGRAIKAGRVWTNCYHAYPAHAAFGGYKESGIGRE
THKMMLDHYQQTKNLLVSYSENKLGFF
Download sequence
Identical sequences A0A031HX48 A0A072TB32 A0A087ELV7 A0A1C7LIQ7 A0A1H3LG59 A0A210W369 A0A2G7T468 A9BXK2 F6AUP8 S2X008 S2X7B9
398578.Daci_5650 gi|160901081|ref|YP_001566663.1| gi|333912609|ref|YP_004486341.1| WP_012207447.1.14625 WP_012207447.1.15632 WP_012207447.1.1853 WP_012207447.1.21606 WP_012207447.1.21876 WP_012207447.1.32055 WP_012207447.1.33911 WP_012207447.1.37708 WP_012207447.1.44721 WP_012207447.1.52897 WP_012207447.1.54325 WP_012207447.1.66548 WP_012207447.1.76905 WP_012207447.1.8197 WP_012207447.1.82428 WP_012207447.1.86732 WP_012207447.1.89816 WP_012207447.1.93318 WP_012207447.1.99124 WP_012207447.1.99347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]