SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160901431|ref|YP_001567013.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160901431|ref|YP_001567013.1|
Domain Number 1 Region: 12-425
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-114
Family ALDH-like 0.0000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160901431|ref|YP_001567013.1|
Sequence length 426
Comment gamma-glutamyl phosphate reductase [Delftia acidovorans SPH-1]
Sequence
MNALNIVEYTHNLGVQAKVASAQMARASAAVKSRALLALARLLRENVEPLQTDNARDLDR
AVANGLSAPMVDRLRLTPKVLETCAQGCEQLASMADVIGEIIGMKQMPSGIRVGQMRVPI
GVFGMIYESRPNVTIEAASLSIKSGNACILRGGSEAIDSNKALAALVARALAEAGLPEHG
VQLVQTTDREAVGQLIAMPDYVDVIIPRGGKGLIERISREAKVPVIKHLDGNCHTYVDDP
CDIAMAVKVADNAKTNKYSPCNASESLLVARGVAAEFLPQIGAIYAAKGVEMRGCPESLA
ILKSVAGAQLAEATEQDWSEEYLAPIISVKIVAGVDEAIAHINRYSSHHTDAILTRDHMH
AQRFLREVDSASVMVNASTRFADGFEYGLGAEIGISTDKFHARGPVGIEGLTSLKYVVLG
EGEVRT
Download sequence
Identical sequences A0A080NTC3 A0A1C7LK39 A0A2G6TR85 A0A2G6VZX7 A0A2G7T2R1 A9C1G5 F6AQU5
gi|160901431|ref|YP_001567013.1| WP_012207797.1.21606 WP_012207797.1.32055 WP_012207797.1.33911 WP_012207797.1.37708 WP_012207797.1.82428 WP_012207797.1.86732 WP_012207797.1.89816 gi|333917469|ref|YP_004491201.1| 398578.Daci_6000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]