SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160895549|ref|YP_001561131.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160895549|ref|YP_001561131.1|
Domain Number 1 Region: 13-483
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-175
Family ALDH-like 0.0000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160895549|ref|YP_001561131.1|
Sequence length 484
Comment succinate-semialdehyde dehydrogenase [Delftia acidovorans SPH-1]
Sequence
MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVPRMGEAETQRAIAAAE
RAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPLAESRGEIAYAASYVQW
FAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAAMITRKVAPALAAGCTII
VKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVLTASMAVRKLTFTGSTEVG
RVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMASKYRNTGQTCVCANRLLVQ
DGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVDKVEELVADAVKNGAEVVLGG
KRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRFKTEEEAIRMANDTEYGLAAYF
YARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVKQSGMGREGGAAGIEEYLSTKYL
CMGH
Download sequence
Identical sequences A0A286JAK9 A9BQP4
398578.Daci_0100 WP_012202039.1.82428 gi|160895549|ref|YP_001561131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]