SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160898763|ref|YP_001564345.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160898763|ref|YP_001564345.1|
Domain Number 1 Region: 444-582
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-33
Family Flavohemoglobin, C-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 339-437
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.15e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 569-681
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-17
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 4 Region: 180-297
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000000168
Family PNP-oxidase like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160898763|ref|YP_001564345.1|
Sequence length 691
Comment oxidoreductase FAD/NAD(P)-binding subunit [Delftia acidovorans SPH-1]
Sequence
MHPQPPKNPASPWHAGELAIQQSVGVVGRMDMPGRKFVRPFLLDQHREFYPLLHFVVLGS
VDAQGDAWATVRAGEPGFLHSPDPSTLHVAAGRDAADPAEPGLADGRAVGLLGMDPMTRR
RNRLNGTVRRKTGVDGAGAFDIGVVQSFGNCPRYIQNRSVRFVRPADEPTQVPAIELASL
DPRAQALIAQADTFYVASYVDGEDGLRQVDVSHRGGKPGFVRIDADGTLTIPDFSGNLFF
MTLGNFLVNPKAGLLFIDSETGEMLQMTGEASVILDSPEIAAFEGAERLWTFKPRRIVRR
PDALPLRWSMAADGWSPHLQMTGSWADASQRLAAARLGRQWRPFRVAQAVDESSTIRSLY
LEPADGMATVAPLAGQHLPLRLMLADGSHLQRTYTLSLAPSDGRLRISVKRQGRASSHLH
GLKPGDLVEARPPAGSFTADAALRRPAVLLAAGIGITPLLAMLRHIVHEGRRTRSLRPTW
LFQAARTRDERAFDAEIAELVKAGNAEVHWVRTLSQPGTAKAGRDYDHEGHIDMALLKAT
LPWDDYDFYLCGPDTFMQATYDGLRERNVPDERIHAEAFGPSALKRSMAGAAPAAELPAP
ATQPVRIIFADSAKEARWKPGDGNLLEVAEARGLEPAFGCRGGSCGDCRARVLEGGVTYA
SPPSFAVPAGEALICCAVPAQGTGEALHLAL
Download sequence
Identical sequences A9BZQ2
WP_012205160.1.82428 398578.Daci_3322 gi|160898763|ref|YP_001564345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]