SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157368507|ref|YP_001476496.1| from Serratia proteamaculans 568

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157368507|ref|YP_001476496.1|
Domain Number 1 Region: 14-333
Classification Level Classification E-value
Superfamily FMN-binding split barrel 5.89e-129
Family UbiD middle domain-like 0.0000000000268
Further Details:      
 
Domain Number 2 Region: 334-497
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 7.85e-68
Family UbiD C-terminal domain-like 0.0000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157368507|ref|YP_001476496.1|
Sequence length 506
Comment 3-octaprenyl-4-hydroxybenzoate decarboxylase [Serratia proteamaculans 568]
Sequence
MPFSLAVIMISMKYRDLRDFLSLLEKRGELKRISQPIDPYLEMTEIADRTLRAGGPALLF
ENPKGYDMPVLCNLFGTPGRVAMGMGQEDVSSLREVGKLLAFLKEPEPPKGFRDLFDKLP
KFKQVLNMPTKVLGSAPCQEQVWQGDDVDLSRIPVMHCWPEDAAPLITWGLTVTRGPQKE
RQNLGIYRQQVLSKNKVIMRWLSHRGGALDYQEWCQAHPGERFPVAVALGADPATILGAV
TPVPDTLSEYAFAGLLRGNKTEVVKCISCDLEVPASAEIVLEGYIEPGEMAPEGPYGDHT
GYYNEIDHFPVFTITHITQRRDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIV
DFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWND
VIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIQ
MDEKVRARVDEIWDELAIFSDREPTL
Download sequence
Identical sequences A8G8C8
gi|157368507|ref|YP_001476496.1| WP_012004727.1.35080 399741.Spro_0258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]