SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347527964|ref|YP_004834711.1| from Sphingobium sp. SYK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347527964|ref|YP_004834711.1|
Domain Number 1 Region: 33-124
Classification Level Classification E-value
Superfamily YccV-like 9.94e-34
Family YccV-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347527964|ref|YP_004834711.1|
Sequence length 136
Comment putative DNA-binding protein [Sphingobium sp. SYK-6]
Sequence
MKQSPNDKRNAIPPELAAALPGALGAAPRIAHARFRIGDTVRHRMFGFRGVVFDIDPVFA
NSEEWYEAIPVAARPPRDQPFYHLFADNGESSYVAYVSQQNLVADETGDPIDHPAIDALF
ERKADGGYALGASRWH
Download sequence
Identical sequences G2IS94
WP_014075905.1.10870 gi|347527964|ref|YP_004834711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]