SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163840662|ref|YP_001625067.1| from Renibacterium salmoninarum ATCC 33209

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163840662|ref|YP_001625067.1|
Domain Number 1 Region: 193-331
Classification Level Classification E-value
Superfamily CBS-domain pair 4.72e-31
Family CBS-domain pair 0.0023
Further Details:      
 
Domain Number 2 Region: 341-428
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.36e-18
Family CorC/HlyC domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163840662|ref|YP_001625067.1|
Sequence length 430
Comment hemolysin [Renibacterium salmoninarum ATCC 33209]
Sequence
MITAVLLVMALVFVAIAGFITMAEAALSFLPRNVADSIQDERDPGVRQRQTALRSVLDKL
IDHQNALRFWRIWFETAAAVAVAMLFLNLIDNLWLAGLLATVVMAGIGLVLVGVSPRQIG
RLHPVEVLRATAWMVRFLCWILGLIPRWLVALGSAVAPGAPRQENAFVSEEEFREFVDRA
SESDMIEDDEVDFIQGVFDLDETLVRAVMVPRTDIVSIERGSSLKQALALFIRSGYSRVP
VIGDDADQVLGVLYLKDVVATQQRLADGEQGPRVESLSREVRYVPESKQVGELLKELQKE
STHVAIVIDEYGGTAGLVTLEDLIEEIVGEIVDEYDAEDSEVEEIGPNSYRVSAQMNIED
LGELFGIDLDDDEVDTVGGLLAKRLGRVPIVGSRIEIDGLDLLADRLEGRRNRVSHVIVS
RAEPVQTENE
Download sequence
Identical sequences A9WQS4
288705.RSal33209_1920 gi|163840662|ref|YP_001625067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]