SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031357|ref|YP_001666588.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031357|ref|YP_001666588.1|
Domain Number 1 Region: 108-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.64e-37
Family Reductases 0.035
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.55e-27
Family Ferredoxin reductase FAD-binding domain-like 0.0035
Further Details:      
 
Domain Number 3 Region: 243-365
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167031357|ref|YP_001666588.1|
Sequence length 366
Comment oxidoreductase FAD-binding subunit [Pseudomonas putida GB-1]
Sequence
MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPIMFFFKPGQFVTLELEI
EGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMHEGAELPVHGPVGLFNAID
FPAGKALYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSPKDIIYHRELEQMASRIP
NFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYMERVVFCCGPTPYMTAVKRMLEAV
GFDMKNYHEESFGATPAEAKADAVEHAEQAAEAPELDVSDLNLVEFIGSEKSIRIAPGET
VHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVEMEHNGGITEEDEAEGYILSCCSVPKG
DVRIDY
Download sequence
Identical sequences B0KI66
WP_012270113.1.13892 WP_012270113.1.54657 WP_012270113.1.65540 WP_012270113.1.66485 WP_012270113.1.81634 gi|167031357|ref|YP_001666588.1| 76869.PputGB1_0339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]