SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031550|ref|YP_001666781.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031550|ref|YP_001666781.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.33e-50
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167031550|ref|YP_001666781.1|
Sequence length 218
Comment formate dehydrogenase subunit gamma [Pseudomonas putida GB-1]
Sequence
MSDNKPILRYNANERTNHWIVAILFFMAGLSGLALFHPALFWLSHLFGGGPWTRILHPFM
GVAMFVFFLGLVIRFWRANFITANDRLWLRRIDRVMVNREDGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYRDVTGDKTPGNHGRKEG
Download sequence
Identical sequences B0KKB7
gi|167031550|ref|YP_001666781.1| 76869.PputGB1_0534 WP_012270261.1.54657 WP_012270261.1.65540 WP_012270261.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]