SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031862|ref|YP_001667093.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031862|ref|YP_001667093.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Globin-like 4.66e-39
Family Globins 0.000052
Further Details:      
 
Domain Number 2 Region: 257-388
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.2e-35
Family Flavohemoglobin, C-terminal domain 0.0028
Further Details:      
 
Domain Number 3 Region: 151-253
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.87e-29
Family Ferredoxin reductase FAD-binding domain-like 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167031862|ref|YP_001667093.1|
Sequence length 392
Comment nitric oxide dioxygenase [Pseudomonas putida GB-1]
Sequence
MLNAEQRAIIKATVPLLESGGEALTTHFYKMMLSEYPEVRPLFNQAHQASGDQPRALANG
VLMYARHIDQLEQLGGLVGQIINKHVALQILPEHYPIVGSCLLRAIEEVLGKDIATPAVI
DAWAAAYGQLADILIGAEENLYKEKEEAEGGWRGTREFRLVRREQESSEIVSFYFAPVDG
KPVLKAEPGQYIGLKLDIDGAEQRRNYSLSALCDGKEYRISVKREAGGKVSNYLHDELVV
GDTLQLFPPAGDFTLAASDKPLVLISGGVGITPTLAMLQAALQTRREVHFIHCARNGAVH
AFRDWIDGLAARHPQLKRFYCYAEPEGGAAADAVGLLSEDLLAEWLPQERDVDAYFLGPK
AFMAAVKRQLKGLGVPEQQSRYEFFGPAAALE
Download sequence
Identical sequences B0KPD8
WP_012270556.1.65540 WP_012270556.1.81634 76869.PputGB1_0847 gi|167031862|ref|YP_001667093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]