SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167031918|ref|YP_001667149.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167031918|ref|YP_001667149.1|
Domain Number 1 Region: 707-850
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.32e-37
Family NADPH-cytochrome p450 reductase-like 0.00085
Further Details:      
 
Domain Number 2 Region: 393-533
Classification Level Classification E-value
Superfamily Flavoproteins 1.39e-36
Family Cytochrome p450 reductase N-terminal domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 538-709
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.46e-23
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167031918|ref|YP_001667149.1|
Sequence length 850
Comment flavodoxin/nitric oxide synthase [Pseudomonas putida GB-1]
Sequence
MKKTLFQLHWFFGITAGLVLALMGITGALYSFQEELLRAFNADVLKVEVRAEGVLPPAEL
VQRVEAQQHDKVSMLWVDVREGNAARIFFMPPPGERRGELRYADPYTGELKGEVAGQGFF
NLMLNLHRFLAMGDTGRQITGACTLMLVFFCLSGLYLRWPRKALDWRTWLTFDWAKKGRA
FNWDLHAVAGTWCLLFYLLFALTGLFWSYEWYREGLNKLLADAPAAGQQQKRGEGRGRHG
PQKVDKNAPPLVVDYDAIWSNLKDAAGPGLAAYNLRLPPVGGQPANLFYLLDNADHPRAF
NTLVLDPTTGQVKNHDRYTDKSFKAQLLQSVYALHVGEYFGLPGRIIVTIASLTMPLFFV
TGWLLYLDRRRKKRQVREARGNVASSNGSGDSWLIGFASQSGFAEQLAWQSAGQLQAAGL
PVQVRALAELGENDLRQARRALFVVSTFGDGEAPDSARAFERKVLGQPWVLNDLSYALLA
LGDRQYPHFCGFARRLQAWLGERGASSAFSPVEVDNADQAALQQWQQELAQLTGAQPVAA
WQPPSFGNWSLVHRELLNPGSQGQPVYLLGLRPEAPASWEAGDLVEILPLNGQPRIDAFL
KGMALDSNTQVQVNGLSETLAQALAGRQLPTRRDHLIGLQPQALIDALVPIGSREYSIAS
IASDGVLELIVRQERHADGHLGLGSGWLTEYLPLNGTLSLRLRRNSGFHLPETAAPLILI
GNGTGIAGLRSLIRARANAGEQRNWLLFGERNRAHDLLCGDELQGWLDSGDLARLDLAFS
RDQAEKVYVQDVLLQQADAFKRWVAEGACVYVCGSLQGMAAGVDAALNGMLGEAAVQQLI
EDGRYRRDVY
Download sequence
Identical sequences B0KPJ4
76869.PputGB1_0903 gi|167031918|ref|YP_001667149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]