SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032252|ref|YP_001667483.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032252|ref|YP_001667483.1|
Domain Number 1 Region: 103-257
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.2e-45
Family Reductases 0.000000306
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167032252|ref|YP_001667483.1|
Sequence length 259
Comment oxidoreductase FAD/NAD(P)-binding subunit [Pseudomonas putida GB-1]
Sequence
MSNMNHERVLSVHHWNDTLFSFKCTRDPGLRFENGQFVMIGLQQESGRPLMRAYSIASPN
WEEHLEFFSIKVPDGPLTSQLQHLKEGDEIIISKKPTGTLVLDDLNPGKHLYLLSTGTGL
APFMSVIQDPETYERFEKVILVHGVRYVNEVAYREFITEHLPQNEFFGESVREKLIYYPT
VTREPFENQGRLTDLMRSGKLFSDIGLPPINPQDDRAMICGSPSMLDETSEVLDSFGLKV
SARMREPGDYLIERAFVEK
Download sequence
Identical sequences A0A1L7N8Y8 B0KT29 R9V329
76869.PputGB1_1240 gi|167032252|ref|YP_001667483.1| WP_012270923.1.13892 WP_012270923.1.17209 WP_012270923.1.54657 WP_012270923.1.65540 WP_012270923.1.66485 WP_012270923.1.68951 WP_012270923.1.79655 WP_012270923.1.81634 WP_012270923.1.99808 gi|512577084|ref|YP_008092979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]