SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032314|ref|YP_001667545.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032314|ref|YP_001667545.1|
Domain Number 1 Region: 5-601
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 3.93e-180
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000000106
Further Details:      
 
Domain Number 2 Region: 970-1184
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.97e-60
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0000845
Further Details:      
 
Domain Number 3 Region: 571-716
Classification Level Classification E-value
Superfamily ADC-like 4.52e-49
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00015
Further Details:      
 
Domain Number 4 Region: 1187-1338
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.89e-47
Family NADPH-cytochrome p450 reductase-like 0.0002
Further Details:      
 
Domain Number 5 Region: 821-961
Classification Level Classification E-value
Superfamily Flavoproteins 4.39e-40
Family Cytochrome p450 reductase N-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167032314|ref|YP_001667545.1|
Sequence length 1338
Comment molybdopterin oxidoreductase [Pseudomonas putida GB-1]
Sequence
MANSEVRSVCPYCGVGCGIVMSVADGKVGKISGDKQHPSNFGRLCTKGLTAHLPLSAAGR
MADAYVRQQRSQPPVRTSMDQAITDTAMRLRGIIDQHGADAVALYVSGQMSLEAQYLANK
LAKGFIRTRHIESNSRLCMASAGSGYKLSLGADGPPGSYQDFEHADVFLVIGANMADCHP
ILFLRLLDRVKAGARLIVVDPRRSATADKADLFLQVRPGSDMALLNGFLHLLQRNGHTNP
DFIARHTEGWDELPPFLDDYTPERVAAITGLAEADIIQAADWIGSASNWMSCWTMGLNQS
IHGTWHSNAICNLHLATGAICRPGSGPFSLTGQPNAMGGREMGYMGPGLPGQRSALVATD
RAFVEQQWQLAPGSLRSEGGEGTVALFEQMKAGEVKACWIICSNPVASVANRQQVIDGLR
EAELVITQDAFLDTETNRYADILLPAALWAEGEGVMINSERNLTLMPRAVQPPGQSLPDW
QIIARVACAMGYADAFDYPDAEAVYEEIRRFHNPLTGYDLRGIGYAELRTQPRQWPCAPG
REQARSPLRYLNDGSSQALLLDAQGQRPALAFPTASGKARFFARPWLPAPELPNDDYPMV
LNTGRVQHQWHTLTKTGKVPALNKLEPGPFVEIHPEDAARLGVAEKDQVAIRSRRGQAVL
PARISDRVMPGNCFAPFHWNDLIGEQLAINAVTCDAVDPLSLQPAFKHCAVALERVASER
IDALDLNTATSEPARMPTATLSRLLGLDTLPTPVLAEEERHYLQGFLLGLDQARAEGVPA
LPASAPLAANRRLFVDGLLAGLFAQPATAPPAALTVPLHQVLWASQTGNGELLAERCAER
LRGAGLSVQLRCMEAVSPSQLQGAASVVLIASTFGDGDAPDSAAAFWQALQGEGGAHCAE
LPYAVLALGDSSYDQFCGFGRKLDLRLAELGGRRLLQRVDCEPDFDEAFAGWLEALLAEL
GSATAPLPASDPAPVAAYSKQQPWAATLRENRLLNGPGASKETRQLVFDLSGSGFTYAAG
DALGVWPRNCPALVDELLALTQLDGQALVELKGQPAMPLAEALQAHLEIAKVSPQQLQAF
AGNAPDLQRLLQPACKAELQDWLWGRQLTDVLRAFPQQLPLAHWLELLKPLQPRLYSISS
SPLAHPEQVHLTVSTVRYGKRKGVCSSFLADRAQALKVAIFPQVSKHFRLPEDDNVPVIM
VGPGTGIAPFRAFLEEREARGAKGGNWLFFGEQYAATDFYYREQLQAWQAGGHLRLDTAF
SRDQAEKIYVQQRLREQGAQVWQWLEAGAYFYVCGDAQRMAKDVDAALREVIAVHGKVDA
DAYVETLNKAKRYRRDVY
Download sequence
Identical sequences B0KTS0
WP_012270983.1.65540 WP_012270983.1.81634 76869.PputGB1_1302 gi|167032314|ref|YP_001667545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]