SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032778|ref|YP_001668009.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032778|ref|YP_001668009.1|
Domain Number 1 Region: 111-275
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.45e-22
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 19-116
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.53e-18
Family Ferredoxin reductase FAD-binding domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167032778|ref|YP_001668009.1|
Sequence length 276
Comment oxidoreductase FAD-binding subunit [Pseudomonas putida GB-1]
Sequence
MNVISGCCQATAITPPNDTLAVVISNEWVNDEYKRLVLQADGAACQSLPGQFFNLLCPNE
GDNKPYFRRPMSTYKADPSKGQVEFLYKVTGKGTYGLETLREAQTLEILGPLGKGFDLDS
SWDHMIIVARGVGLATLAPLAEAAHQLGIRLTAVLSARSEKSLLSRERFASLGADVQVVL
DEDGSSAPDQLEHLLRQIIAREKTSALFTCGSKRLTRLLKKLSAELGLVGQVALEQQMVC
GLGMCQCCVEVFEVDGLRVGKRVCLEGPVFDLAEVV
Download sequence
Identical sequences B0KI97
gi|167032778|ref|YP_001668009.1| 76869.PputGB1_1770 WP_012271432.1.13892 WP_012271432.1.54657 WP_012271432.1.65540 WP_012271432.1.66485 WP_012271432.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]