SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167032817|ref|YP_001668048.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167032817|ref|YP_001668048.1|
Domain Number 1 Region: 243-778
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 8.11e-194
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000245
Further Details:      
 
Domain Number 2 Region: 783-925
Classification Level Classification E-value
Superfamily ADC-like 1.47e-40
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 99-236
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.63e-36
Family Ferredoxin domains from multidomain proteins 0.0084
Further Details:      
 
Domain Number 4 Region: 26-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.22e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167032817|ref|YP_001668048.1|
Sequence length 960
Comment formate dehydrogenase subunit alpha [Pseudomonas putida GB-1]
Sequence
MINFFDPASDKNSDLGTPARDSDVQVSLSIDGRAISVPAGTSVMRAAAMLGTSIPKLCAT
DSLEAFGSCRMCMVEIEGMRGYPASCTTPVSEGMVVRTETPRLAGLRRNVMELYISDHPL
DCLTCSANGNCELQTVAGQVGLREVRYGYDGANHLAEKKDVSNPYFDYEPSKCIVCSRCV
RACEDIQGTFALTITGRGFESRVAAAGGDDFLTSECVSCGACVQACPTATLTEKSLVQLG
QPERSVITTCAYCGVGCSFRAEMKGDQLVRMVPDKNGGANHGHACVKGRFAWGYATHPDR
ITKPMIRKRLEDPWQEVSWDEAVTYAASEFRRIQLKYGRDAIGGITSSRCTNEEAYLVQK
LVRTAFGNNNVDTCARVCHSPTGYGLKQTLGESAGTQSFDSVMQADVVLVIGANPTDAHP
VFGSQLKRRLRQGARLIVIDPRRIDLVDSPHARAELHLQLRPGTNVAMLNALAHVIVTEG
LLAQRFIDARCETEDFARWRDFVSLADNAPEVLGPVCGVPAEQIRAAARLYATGGNAAIY
YGLGVTEHSQGSTAVMGIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSFPHELPGY
RHISNEGVRAEFERAWGVTLQPDPGLRIPNMFEAALDGSFKALYCQGEDIAQSDPNTQHV
TAALHAMECVVVQDIFLNETAKFAHVFLPGSSFLEKDGTFTNAERRISRVRKVMEPLAGK
ADWEATVALANALGYPMNYRHPSEIMDEIARLTPTFRRVSYAEIDRHGSLQWPCNDAAPD
GTPTMHIDQFVRGKGRFMLTGYVPTDEKVNNRYPLLLTTGRILSQYNVGAQTRRTGNVAW
HDADRLEIHPTDAESRGIQDGDWVGIGSRAGQTVLRAKVSARVAPGVVYTTFHFPESGAN
VITTDNSDWATNCPEYKVTAVEVVKVFQPSQWQKRYQDFSDEQRRLLIERRTAEKAEVRR
Download sequence
Identical sequences B0KID6
76869.PputGB1_1809 WP_012271471.1.13892 WP_012271471.1.54657 WP_012271471.1.66485 WP_012271471.1.81634 gi|167032817|ref|YP_001668048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]