SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033175|ref|YP_001668406.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033175|ref|YP_001668406.1|
Domain Number 1 Region: 208-315
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.36e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0062
Further Details:      
 
Domain Number 2 Region: 102-220
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.03e-27
Family Aromatic dioxygenase reductase-like 0.012
Further Details:      
 
Domain Number 3 Region: 2-96
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.84e-27
Family Ferredoxin reductase FAD-binding domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167033175|ref|YP_001668406.1|
Sequence length 316
Comment ferredoxin [Pseudomonas putida GB-1]
Sequence
MIDAVVVSRNDEAQGICSFELAAADGSLLPAFSAGAHIDVHLPDGLVRQYSLCNHPEERH
RYLIGVLNDPASRGGSRSLHEQVQAGARLRISAPRNLFPLAEGAQRSLLFAGGIGITPIL
CMAEQLSHSGHDFELHYCARSSERAAFVERIRNAPFADRLFVHFDEQPETALDIARVLGN
PQEDAHLYVCGPGGFMQHVLDSAKGLGWQEANLHREYFAAAPVDASNDGSFSVQVGSTGQ
VFEVPADQTVVQVLEQHGIEIAMSCEQGICGTCLTRVLQGTPDHRDMFLTEEEQALNDQF
TPCCSRSKTPLLVLDI
Download sequence
Identical sequences B0KML4
76869.PputGB1_2169 gi|167033175|ref|YP_001668406.1| WP_012271819.1.65540 WP_012271819.1.66485 WP_012271819.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]