SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033626|ref|YP_001668857.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033626|ref|YP_001668857.1|
Domain Number 1 Region: 109-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.1e-33
Family Flavohemoglobin, C-terminal domain 0.057
Further Details:      
 
Domain Number 2 Region: 236-354
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.21e-27
Family 2Fe-2S ferredoxin-related 0.0053
Further Details:      
 
Domain Number 3 Region: 2-105
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.77e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167033626|ref|YP_001668857.1|
Sequence length 358
Comment phenylacetate-CoA oxygenase/reductase subunit PaaK [Pseudomonas putida GB-1]
Sequence
MSQFHSLTIKQVRNETRDAVSIAFDVPEHLQDQFRFTQGQYLVMRTQLDNEEVRRSYSIC
SAVQDGELRVAVKRVPGGRFSAFANEVLKAGQQLEVMPPSGSFFVPLDPTRQGNYLGVAA
GSGITPILSIIATTLASEPNSRFTLLYGNRSSSGALFRDKLEDLKNTYLDRLNLIFVFSR
EQQDVDLYNGRIDADKCGQLFSRWLDVPGLDAAFICGPQAMTETVRDSLQANGLEKQRIH
FELFAAAGNEARREAREAARQVDAALSHITVISDGRALTFDLPRNTQNVLDAGNAIGAEL
PYSCKAGVCSTCKCRVIEGEVEMDSNHALEDYEVAAGYVLSCQTYPVSDKVVLDFDQL
Download sequence
Identical sequences B0KSJ6
gi|167033626|ref|YP_001668857.1| 76869.PputGB1_2622 WP_012272261.1.65540 WP_012272261.1.66485 WP_012272261.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]