SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033688|ref|YP_001668919.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033688|ref|YP_001668919.1|
Domain Number 1 Region: 204-333
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.02e-35
Family Aromatic dioxygenase reductase-like 0.0000624
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 76-205
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.87e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167033688|ref|YP_001668919.1|
Sequence length 336
Comment oxidoreductase FAD/NAD(P)-binding subunit [Pseudomonas putida GB-1]
Sequence
MSYQIALNFEDGVTRFIEASGHETVADAAYRQGINIPLDCRDGACGTCKCKAESGRYDLG
DNFIEDALSEDEIAEGYVLTCQMRAESDCVIRIPASSQLCKTEQASFEAAISDVRQLSAS
TIALSIKGEALSRLAFLPGQYVNLKVPGSEQSRAYSFSSLQKDGEVSFLIRNVPGGLMSS
FLTNLAKAGDNMSLAGPLGSFYLRPIQRPLLLLAGGTGLAPFTAMLERIAEQGSEHPLHL
IYGVTNDFDLVELDRLQALASRIPNFTYSACVANPDSQYPQKGYVTQHIEPRHLNDGDVD
VYLCGPPPMVEAVSQYVREQGITPANFYYEKFAAAA
Download sequence
Identical sequences B0KT96
76869.PputGB1_2686 gi|167033688|ref|YP_001668919.1| WP_012272323.1.13892 WP_012272323.1.54657 WP_012272323.1.65540 WP_012272323.1.66485 WP_012272323.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]