SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167033784|ref|YP_001669015.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033784|ref|YP_001669015.1|
Domain Number 1 Region: 26-181
Classification Level Classification E-value
Superfamily PEBP-like 1.28e-39
Family Prokaryotic PEBP-like proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167033784|ref|YP_001669015.1|
Sequence length 183
Comment PEBP family protein [Pseudomonas putida GB-1]
Sequence
MNLKPWLLAALMPCAALANSSNQGALSISSSSFTDGGVIALQQVGLDPACGAGEERTPQL
SWDNLPEGTQSLALIMFDPDGGKGVGVVHWVAYNIDPEQDGLKEGMAGLSGQYLTVGRNS
RGTRSYRGPCPPAGDNPHHYALTLIATDLPLGTLPEDLDRNGLLELLQGHALGAQSLVGR
YGH
Download sequence
Identical sequences B0KU16
gi|167033784|ref|YP_001669015.1| 76869.PputGB1_2785 WP_012272418.1.13892 WP_012272418.1.54657 WP_012272418.1.66485 WP_012272418.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]