SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167033895|ref|YP_001669126.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167033895|ref|YP_001669126.1|
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.8e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167033895|ref|YP_001669126.1|
Sequence length 177
Comment cytochrome B561 [Pseudomonas putida GB-1]
Sequence
MKPEAFHPFARLLHWLMAVLILAMLFIGVSMVADLSPRHPLLISLHKATGLALLVLVLLR
IAVRLSVPHPPLPHDLPVLQRWAAGASHLLLYGLMLAMPLLGWAMLSAGDYPRPLGLPAI
APHNLQLYAVLRQAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLRRSE
Download sequence
Identical sequences B0KUV8
gi|167033895|ref|YP_001669126.1| WP_012272526.1.13892 WP_012272526.1.54657 WP_012272526.1.65540 WP_012272526.1.66485 WP_012272526.1.81634 76869.PputGB1_2896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]