SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167034083|ref|YP_001669314.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034083|ref|YP_001669314.1|
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.15e-19
Family LysR-like transcriptional regulators 0.003
Further Details:      
 
Domain Number 2 Region: 94-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.29e-19
Family Phosphate binding protein-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167034083|ref|YP_001669314.1|
Sequence length 312
Comment MarR family transcriptional regulator [Pseudomonas putida GB-1]
Sequence
MKLHQLRALVAIHNAGSILEASKLMHITQPALSRSIKELEREVGFILLQRSHKGMALTEE
GKRVIRHANLVVESIRRLQIEAASIQDAALGAVSIGVTSLTAMLDGVDESILAFRRKYPR
VKITITDLRPSQILQRLRDGSLDFAITSQQPLSRLSLDWEALGSIKGRVICHASNQQKFT
QSLRTLQYAHWISLDELSDQASQFHQLFEANGLRVPQNTVECTSVMMALKLLKNTESLMT
ISQLAVDQGFTFGVDCEYLAMPVQELIPDYPINLVCIDRHSLTAPAQELFHSLRGQVLRQ
TRPVASEVVVHA
Download sequence
Identical sequences B0KGH7
gi|167034083|ref|YP_001669314.1| 76869.PputGB1_3086 WP_012272708.1.65540 WP_012272708.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]