SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034185|ref|YP_001669416.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034185|ref|YP_001669416.1|
Domain Number 1 Region: 374-576
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-25
Family Creatinase/aminopeptidase 0.0026
Further Details:      
 
Domain Number 2 Region: 226-346
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.32e-23
Family Reductases 0.0064
Further Details:      
 
Domain Number 3 Region: 30-119
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.18e-22
Family 2Fe-2S ferredoxin-related 0.041
Further Details:      
 
Domain Number 4 Region: 130-223
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.33e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167034185|ref|YP_001669416.1|
Sequence length 588
Comment ferredoxin [Pseudomonas putida GB-1]
Sequence
MNYPKLEVLLVLDYSNNRTSNCPEVFMQSRHVIELSPSGKTFDASHELLLDAMLASGLPV
PFSCRRGACGSCKVKVVSGQYQDKQRDADTPAPSYPLAADEMLLCQSHACSDMRLEIPGW
SLDTPTLETHAQVVGQRALSNDIVELVLQPAQPLDVRAGQYVRFRLDNGDSRCFSIANLP
AQQQGQLVFHIRKVSGGLFTEGLLPTLQAGASVKLEGPLGACTWQHDEQRPLVLLATGTG
YAGIKPLLLTALARDAEVALYWGGSSTADFYDHAFLDQASGAHPHFRWYPVLAGQARIQQ
VALGQPHHWEETQVYACGNPAMISQAREQCVAAGVLPHRFVAEAFVASGAAATQASAAST
LHPELEKVGPRYSLDGMLAAREQSVRSVAAIASQLQVGMTTAQALEMAAQTLQAMGASHT
WHPTYIRFGDDTVRTPRQGIDLQRVLRSTDIVVVDVGPVWDGYEGDYGDTFVFGQHPLHH
ACVKALHEVFDETRQAWGRGLTGRELYDFAERSAQAKGWQLERNLAGHRIADFPHVLYGQ
DKLAEVGIVPSEVVWVLEIQLCHPTEPVGAFFEDILIGDARSAVATAA
Download sequence
Identical sequences B0KHJ8
WP_012272809.1.65540 WP_012272809.1.81634 gi|167034185|ref|YP_001669416.1| 76869.PputGB1_3188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]