SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034205|ref|YP_001669436.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034205|ref|YP_001669436.1|
Domain Number 1 Region: 15-91
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000275
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167034205|ref|YP_001669436.1|
Sequence length 96
Comment hypothetical protein PputGB1_3208 [Pseudomonas putida GB-1]
Sequence
MPLFKRVAEHDREPVPFLLDGQPAQGMHGDTLLTAILTHSEHLRGSDFSAEPRAGFCLMG
ACQDCWVRLQDGRRVRACSTFLEPGHCVSRDPGRRP
Download sequence
Identical sequences B0KHL8
76869.PputGB1_3208 WP_012272829.1.13892 WP_012272829.1.54657 WP_012272829.1.65540 WP_012272829.1.66485 WP_012272829.1.81634 gi|167034205|ref|YP_001669436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]