SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034303|ref|YP_001669534.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034303|ref|YP_001669534.1|
Domain Number 1 Region: 204-335
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-35
Family Reductases 0.038
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.57e-30
Family 2Fe-2S ferredoxin-related 0.025
Further Details:      
 
Domain Number 3 Region: 105-199
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.6e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167034303|ref|YP_001669534.1|
Sequence length 353
Comment oxidoreductase FAD-binding subunit [Pseudomonas putida GB-1]
Sequence
MSYQVTIEPTGEQIEVEEGQTILEAALRQGVWLPFACGHGTCATCKCQVLEGEVDLGAAS
SFALMDMERDEGKVLACCAIPQSDLVIEADIDVDPDFAGLPVQDYRAVVTQLVELSPTIR
GVHLKLDRPMAFQAGQYVNLQLPGIEGSRAFSLANPPQQADEVELHVRLVEGGVATGYIH
QQLKVGDALALSGPYGQFFVRGSQPGDLIFIAGGSGLSSPQSMILDLLARGDTRRITLFQ
GARTRAELYNRELFEALAERHANFSYVPALSQAAEDEQWQGVRGYVHDAARQHFDGRFNG
HKAYLCGPPPMIDAAITCLMQGRLFERDIFMERFYSAADGTAEGQRSALFKRI
Download sequence
Identical sequences B0KIP3
gi|167034303|ref|YP_001669534.1| WP_012272927.1.65540 WP_012272927.1.81634 76869.PputGB1_3306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]