SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167034578|ref|YP_001669809.1| from Pseudomonas putida GB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167034578|ref|YP_001669809.1|
Domain Number 1 Region: 86-154
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 9.16e-31
Family CO dehydrogenase ISP C-domain like 0.00047
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.1e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167034578|ref|YP_001669809.1|
Sequence length 157
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Pseudomonas putida GB-1]
Sequence
MQTTISLRINGQPVDVSAMPDTPLLLILRNDLCLNGPKYGCGLGECGACTVIIDGVAARS
CVIPLAGAAGRDITTLEGLGNKAAPHPVQQAFIDEQAAQCGYCMNGMIMTAKALLDRIPD
PTDEQIRNELSGNLCRCGTHVEILRAVRRAAETRRKA
Download sequence
Identical sequences B0KLU5
76869.PputGB1_3582 gi|167034578|ref|YP_001669809.1| WP_012273188.1.13892 WP_012273188.1.54657 WP_012273188.1.65540 WP_012273188.1.66485 WP_012273188.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]